PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0377s0130.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 358aa    MW: 40109.2 Da    PI: 7.4926
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0377s0130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.3e-56171431129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             +ppGfrFhPtdeel+++yL kkv + ++++ ++i +vd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatg
  SapurV1A.0377s0130.1.p  17 MPPGFRFHPTDEELISHYLYKKVLDINFSA-RAIGDVDLNKSEPWELPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATG 102
                             79**************************99.89***************888999********************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kdke+++ +++lvg+kktLvfykgrapkgekt+Wvmheyrle
  SapurV1A.0377s0130.1.p 103 KDKEIYR-GKSLVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 143
                             *******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6414167IPR003441NAC domain
PROSITE profilePS5100559.60317167IPR003441NAC domain
PfamPF023651.2E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MENICGLAKE DDEKMDMPPG FRFHPTDEEL ISHYLYKKVL DINFSARAIG DVDLNKSEPW  60
ELPWKAKMGE KEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYRG KSLVGMKKTL  120
VFYKGRAPKG EKTNWVMHEY RLEGKFAVHN LPKTAKNEWV ICRVFQKSSA GKKTYISGLV  180
RPGSLGSEFN PSGLPPLTDS SPYNGNIKSL ADSADVPCFS NLVQRNQQDT IDSFSNHLLA  240
VSSNPSEVSP RIPLLNSFYS PQAVPASGNL QYPGSVSIQD HSVLKALIEN QGSNMKQQSS  300
KPERDMASAS QDSAADMNTE ISSVISNLEV GNRSFDEQEV PPSTLVQSMD LYCFWNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-551417314171NAC domain-containing protein 19
4dul_A8e-551417314171NAC domain-containing protein 19
1ut7_B8e-551417314171NO APICAL MERISTEM PROTEIN
1ut7_A8e-551417314171NO APICAL MERISTEM PROTEIN
1ut4_B8e-551417314171NO APICAL MERISTEM PROTEIN
1ut4_A8e-551417314171NO APICAL MERISTEM PROTEIN
3swp_D8e-551417317174NAC domain-containing protein 19
3swp_C8e-551417317174NAC domain-containing protein 19
3swp_B8e-551417317174NAC domain-containing protein 19
3swp_A8e-551417317174NAC domain-containing protein 19
3swm_D8e-551417317174NAC domain-containing protein 19
3swm_C8e-551417317174NAC domain-containing protein 19
3swm_B8e-551417317174NAC domain-containing protein 19
3swm_A8e-551417317174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6051550.0KR605155.1 Manihot esculenta NAC transcription factors 17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318383.20.0no apical meristem-like family protein
SwissprotQ9FLJ21e-161NC100_ARATH; NAC domain-containing protein 100
TrEMBLB9I5570.0B9I557_POPTR; No apical meristem-like family protein
STRINGPOPTR_0012s01610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-158NAC domain containing protein 100